PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00091g00074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NAC
Protein Properties Length: 492aa    MW: 54938.4 Da    PI: 7.8133
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00091g00074.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.18.6e-50331591128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                               + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat++gyWk
  Peaxi162Scf00091g00074.1  33 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATETGYWK 116
                               579************************777.99***************667777899**************************** PP

                       NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               atgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey +
  Peaxi162Scf00091g00074.1 117 ATGKERNVKS-GSNIIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 159
                               **********.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-5629176IPR003441NAC domain
PROSITE profilePS5100554.38133177IPR003441NAC domain
PfamPF023653.9E-2635158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MEDGHVRNEN GRGKSPRNNN SNVEISIATA SSMFPGFRFS PTDEELISYY LKKKLEGSDK  60
CVEVISEVEI WKHEPWDLPA KSVIQSDNEW FFFSPRGRKY PNGSQSKRAT ETGYWKATGK  120
ERNVKSGSNI IGTKRTLVFH TGRAPKGQRT QWIMHEYCMS GNTNHQDSMV VCRLRKNSEF  180
HLNDTPRNRR NQLVATDSTT AMSGAGQLGS LELVTGGDCC SKEGSSSFHS HSVEQIDSES  240
ESDNPTKEFS QHDSSSHFKD CDGEEDCFAD IMKDDIIKLD DSSFNAGPVS MVSSGPESSN  300
ISTREAQVKL SNAVPFQGTA NRRLRLVIEK VVEYRVEGSK VHAATKKNKI GTSTTGSASW  360
LRNTGCGILL WNQDINCVQG NTSMNYRKES SHPKLDLKLN LSPPRETIFP RGEISPSRSS  420
SSPTSSCISR EPTPEEQLFG YPNSQTETTS MMLVGCPRCL MYVMLSVEDP KCPKCKSSML  480
LDFFHEDRIK KK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-432917613164NO APICAL MERISTEM PROTEIN
1ut4_B2e-432917613164NO APICAL MERISTEM PROTEIN
1ut7_A2e-432917613164NO APICAL MERISTEM PROTEIN
1ut7_B2e-432917613164NO APICAL MERISTEM PROTEIN
3swm_A2e-432917616167NAC domain-containing protein 19
3swm_B2e-432917616167NAC domain-containing protein 19
3swm_C2e-432917616167NAC domain-containing protein 19
3swm_D2e-432917616167NAC domain-containing protein 19
3swp_A2e-432917616167NAC domain-containing protein 19
3swp_B2e-432917616167NAC domain-containing protein 19
3swp_C2e-432917616167NAC domain-containing protein 19
3swp_D2e-432917616167NAC domain-containing protein 19
4dul_A2e-432917613164NAC domain-containing protein 19
4dul_B2e-432917613164NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-105HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361089.10.0PREDICTED: NAC domain-containing protein 89-like isoform X1
SwissprotQ9XIN72e-85NAC40_ARATH; NAC domain-containing protein 40
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.14e-78NTM1-like 8